PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4348s0011.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 269aa    MW: 31814.7 Da    PI: 6.7608
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4348s0011.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.31.1e-24959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+ien++ rqvtfskRr+g++KK  ELS+LCda + +i+fs tgkl e++s
  Cagra.4348s0011.1.p  9 KKIENQTARQVTFSKRRTGLIKKTRELSILCDAHIGLIVFSATGKLSEFCS 59
                         68***********************************************96 PP

2K-box54.93.7e-19821571085
                K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                          ++ ++ +l++e++ L++e+ nL++ +R + G dL s+   eL  Le+qLe+s+ k+R++Knel+ +q+++l +k  
  Cagra.4348s0011.1.p  82 HQDDQDQLCHEIEVLRRETCNLEHRLRPYHGHDLASIPPHELDVLERQLEHSVLKVRERKNELMQQQLDNLSRKSL 157
                          45567889***************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.899161IPR002100Transcription factor, MADS-box
SMARTSM004329.8E-38160IPR002100Transcription factor, MADS-box
CDDcd002659.94E-43279No hitNo description
SuperFamilySSF554552.88E-30290IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.9E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-263859IPR002100Transcription factor, MADS-box
PfamPF014866.4E-1682157IPR002487Transcription factor, K-box
PROSITE profilePS5129713.26586195IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRGKIEIKK IENQTARQVT FSKRRTGLIK KTRELSILCD AHIGLIVFSA TGKLSEFCSE  60
ANRMPQLIDR YLQTNGLRLP DHQDDQDQLC HEIEVLRRET CNLEHRLRPY HGHDLASIPP  120
HELDVLERQL EHSVLKVRER KNELMQQQLD NLSRKSLLHH GFNDHYYHVY IYEQRKMLEE  180
DNNNMYRWLH EHRAAMELQQ AGIETKPTEY QQFLEQLQYY NNDHQQQQQQ QQPDSLLQLA  240
TLTSQIDPNY HLQLAQPNLQ NDHAPKSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-14275172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-14275172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-14275172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-14275172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S3e-14159159Myocyte-specific enhancer factor 2B
1tqe_R3e-14159159Myocyte-specific enhancer factor 2B
1tqe_Q3e-14159159Myocyte-specific enhancer factor 2B
1tqe_P3e-14159159Myocyte-specific enhancer factor 2B
3p57_J3e-14275172Myocyte-specific enhancer factor 2A
3p57_I3e-14275172Myocyte-specific enhancer factor 2A
3p57_D3e-14275172Myocyte-specific enhancer factor 2A
3p57_C3e-14275172Myocyte-specific enhancer factor 2A
3p57_B3e-14275172Myocyte-specific enhancer factor 2A
3p57_A3e-14275172Myocyte-specific enhancer factor 2A
3kov_J3e-14275172Myocyte-specific enhancer factor 2A
3kov_I3e-14275172Myocyte-specific enhancer factor 2A
3kov_B3e-14275172Myocyte-specific enhancer factor 2A
3kov_A3e-14275172Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3180980.0AJ318098.1 Arabidopsis thaliana mRNA for putative MADS-domain transcription factor (abs gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289310.11e-166hypothetical protein CARUB_v10002792mg
SwissprotQ8RYD91e-145TT16_ARATH; Protein TRANSPARENT TESTA 16
TrEMBLR0HEJ61e-166R0HEJ6_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__2319__AT5G23260.21e-147(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65062543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.21e-130MIKC_MADS family protein